SCOP 1.75: Domain d3cuma2: 3cum A:1-162

Lineage for d3cuma2 (3cum A:1-162)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Hydroxyisobutyrate dehydrogenase [102171] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [159424] (1 PDB entry)
   Uniprot Q9I5I6 1-162

8. Domain d3cuma2: 3cum A:1-162 [156996]
   Other proteins in same PDB: d3cuma1
   complexed with act, edo, peg

Details for d3cuma2

PDB Entry: 3cum, 2.2 Å

PDB Description: Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1

PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOP Domain Sequences for d3cuma2:

Sequence; same for both SEQRES and ATOM records:

>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
mkqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqgadv
vismlpasqhveglyldddgllahiapgtlvlecstiaptsarkihaaarerglamldap
vsggtagaaagtltfmvggdaealekarplfeamgrnifhag

Timeline for d3cuma2:

• d3cuma2 is new in SCOP 1.75
  
• d3cuma2 does not appear in SCOPe 2.01