SCOPe 2.06: Domain d3cula_: 3cul A:

Lineage for d3cula_ (3cul A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (50 PDB entries)
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d3cula_: 3cul A: [156993]
   automated match to d1auda_
   protein/RNA complex; complexed with k, mg

Details for d3cula_

PDB Entry: 3cul, 2.8 Å

PDB Description: aminoacyl-trna synthetase ribozyme

PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d3cula_:

Sequence; same for both SEQRES and ATOM records:

>d3cula_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakm

Timeline for d3cula_:

• d3cula_ first appeared in SCOP 1.75, called d3cula1
  
• d3cula_ appears in SCOPe 2.05
  
• d3cula_ appears in SCOPe 2.07
  
• d3cula_ appears in the current release, SCOPe 2.08