Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Splicesomal U1A protein [54932] (2 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54933] (33 PDB entries) Uniprot P09012 1-97 Uniprot P09012 4-98 Uniprot P09012 1-98 Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98 |
Domain d3cula1: 3cul A:301-392 [156993] automatically matched to d1auda_ complexed with gtp, k, mg; mutant |
PDB Entry: 3cul (more details), 2.8 Å
SCOP Domain Sequences for d3cula1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cula1 d.58.7.1 (A:301-392) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa tnalrsmqgfpfydkpmriqyaktdsdiiakm
Timeline for d3cula1: