Lineage for d1bqz__ (1bqz -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 
Superfamily a.2.3: Chaperone J-domain [46565] (1 family) 
Family a.2.3.1: Chaperone J-domain [46566] (4 proteins) 
Protein DnaJ chaperone, N-terminal (J) domain [46571] (1 species) Species Escherichia coli [TaxId:562] [46572] (3 PDB entries) 
Domain d1bqz__: 1bqz - [15699]
Details for d1bqz__
PDB Entry: 1bqz (more details)
PDB Description: j-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
SCOP Domain Sequences for d1bqz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqz__ a.2.3.1 (-) DnaJ chaperone, N-terminal (J) domain {Escherichia coli}
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeqgg
SCOP Domain Coordinates for d1bqz__:
Click to download the PDB-style file with coordinates for d1bqz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bqz__:
- d1bqz__ appears in SCOP 1.57
- d1bqz__ appears in the current release, SCOPe 2.08, called d1bqza_
View in 3D