Lineage for d1bq0__ (1bq0 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 822Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 823Family a.2.3.1: Chaperone J-domain [46566] (4 proteins)
  6. 824Protein DnaJ chaperone, N-terminal (J) domain [46571] (1 species)
  7. 825Species Escherichia coli [TaxId:562] [46572] (3 PDB entries)
  8. 827Domain d1bq0__: 1bq0 - [15698]

Details for d1bq0__

PDB Entry: 1bq0 (more details)

PDB Description: j-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-104) of the molecular chaperone dnaj, nmr, 20 structures

SCOP Domain Sequences for d1bq0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq0__ a.2.3.1 (-) DnaJ chaperone, N-terminal (J) domain {Escherichia coli}
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeqgg

SCOP Domain Coordinates for d1bq0__:

Click to download the PDB-style file with coordinates for d1bq0__.
(The format of our PDB-style files is described here.)

Timeline for d1bq0__: