Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Ta1064 (RFK), N-terminal domain [158274] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [158275] (1 PDB entry) Uniprot Q9HJA6 5-89 |
Domain d3ctaa1: 3cta A:5-89 [156979] Other proteins in same PDB: d3ctaa2 |
PDB Entry: 3cta (more details), 2.2 Å
SCOPe Domain Sequences for d3ctaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} dqyyraikkikeaaeasnrayltsskladmlgisqqsasriiidlekngyitrtvtkrgq ilnitekgldvlytefadlsrilai
Timeline for d3ctaa1: