SCOPe 2.04: Domain d3csid2: 3csi D:1-78

Lineage for d3csid2 (3csi D:1-78)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)

8. Domain d3csid2: 3csi D:1-78 [156972]
   Other proteins in same PDB: d3csia1, d3csib1, d3csic1, d3csid1
   automated match to d3hkrb1
   complexed with ca, cl, co3, gsh, lz6, mes, so4

Details for d3csid2

PDB Entry: 3csi, 1.9 Å

PDB Description: crystal structure of the glutathione transferase pi allelic variant*c, i104v/a113v, in complex with the chlorambucil-glutathione conjugate

PDB Compounds: (D:) Glutathione S-transferase P

SCOPe Domain Sequences for d3csid2:

Sequence; same for both SEQRES and ATOM records:

>d3csid2 c.47.1.5 (D:1-78) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

Timeline for d3csid2:

• d3csid2 first appeared in SCOP 1.75
  
• d3csid2 appears in SCOPe 2.03
  
• d3csid2 appears in SCOPe 2.05
  
• d3csid2 appears in the current release, SCOPe 2.08