Lineage for d1xbl__ (1xbl -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 
Superfamily a.2.3: Chaperone J-domain [46565] (1 family) 
Family a.2.3.1: Chaperone J-domain [46566] (4 proteins) 
Protein DnaJ chaperone, N-terminal (J) domain [46571] (1 species) Species Escherichia coli [TaxId:562] [46572] (3 PDB entries) 
Domain d1xbl__: 1xbl - [15697]
Details for d1xbl__
PDB Entry: 1xbl (more details)
PDB Description: nmr structure of the j-domain (residues 2-76) in the escherichia coli n-terminal fragment (residues 2-108) of the molecular chaperone dnaj, 20 structures
SCOP Domain Sequences for d1xbl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbl__ a.2.3.1 (-) DnaJ chaperone, N-terminal (J) domain {Escherichia coli}
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeq
SCOP Domain Coordinates for d1xbl__:
Click to download the PDB-style file with coordinates for d1xbl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xbl__:
- d1xbl__ first appeared (with stable ids) in SCOP 1.55
- d1xbl__ appears in SCOP 1.59
- d1xbl__ appears in the current release, SCOPe 2.08, called d1xbla_
View in 3D