Lineage for d3csba2 (3csb A:5-370)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1624950Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)
  6. 1624999Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1625006Species Escherichia coli K-12 [TaxId:83333] [159806] (5 PDB entries)
  8. 1625008Domain d3csba2: 3csb A:5-370 [156960]
    Other proteins in same PDB: d3csba1
    automatically matched to d1mpba_
    complexed with 1pe, edo, mn, peg, pg4, pge

Details for d3csba2

PDB Entry: 3csb (more details), 2 Å

PDB Description: crystal structure of monobody ysx1/maltose binding protein fusion complex
PDB Compounds: (A:) Maltose-binding protein Monobody YSX1 Fusion

SCOPe Domain Sequences for d3csba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3csba2 c.94.1.1 (A:5-370) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]}
gklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwah
drfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpn
ppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvd
nagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv
tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgaval
ksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkda
qtritk

SCOPe Domain Coordinates for d3csba2:

Click to download the PDB-style file with coordinates for d3csba2.
(The format of our PDB-style files is described here.)

Timeline for d3csba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3csba1