Lineage for d1hdj__ (1hdj -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 
Superfamily a.2.3: Chaperone J-domain [46565] (1 family) 
Family a.2.3.1: Chaperone J-domain [46566] (4 proteins) 
Protein HSP40 [46569] (1 species) Species Human (Homo sapiens) [TaxId:9606] [46570] (1 PDB entry) 
Domain d1hdj__: 1hdj - [15696]
Details for d1hdj__
PDB Entry: 1hdj (more details)
PDB Description: human hsp40 (hdj-1), nmr
SCOP Domain Sequences for d1hdj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdj__ a.2.3.1 (-) HSP40 {Human (Homo sapiens)}
mgkdyyqtlglargasdeeikrayrrqalryhpdknkepgaeekfkeiaeaydvlsdprk
reifdrygeeglkgsgc
SCOP Domain Coordinates for d1hdj__:
Click to download the PDB-style file with coordinates for d1hdj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hdj__:
- d1hdj__ first appeared (with stable ids) in SCOP 1.55
- d1hdj__ appears in SCOP 1.59
- d1hdj__ appears in the current release, SCOPe 2.08, called d1hdja1
View in 3D