Lineage for d1hdj__ (1hdj -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 822Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 823Family a.2.3.1: Chaperone J-domain [46566] (4 proteins)
  6. 834Protein HSP40 [46569] (1 species)
  7. 835Species Human (Homo sapiens) [TaxId:9606] [46570] (1 PDB entry)
  8. 836Domain d1hdj__: 1hdj - [15696]

Details for d1hdj__

PDB Entry: 1hdj (more details)

PDB Description: human hsp40 (hdj-1), nmr

SCOP Domain Sequences for d1hdj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdj__ a.2.3.1 (-) HSP40 {Human (Homo sapiens)}
mgkdyyqtlglargasdeeikrayrrqalryhpdknkepgaeekfkeiaeaydvlsdprk
reifdrygeeglkgsgc

SCOP Domain Coordinates for d1hdj__:

Click to download the PDB-style file with coordinates for d1hdj__.
(The format of our PDB-style files is described here.)

Timeline for d1hdj__: