Lineage for d1fpoc1 (1fpo C:1-76)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 822Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 823Family a.2.3.1: Chaperone J-domain [46566] (4 proteins)
  6. 829Protein HSC20 (HSCB), N-terminal (J) domain [46567] (1 species)
  7. 830Species Escherichia coli [TaxId:562] [46568] (1 PDB entry)
  8. 833Domain d1fpoc1: 1fpo C:1-76 [15695]
    Other proteins in same PDB: d1fpoa2, d1fpob2, d1fpoc2

Details for d1fpoc1

PDB Entry: 1fpo (more details), 1.8 Å

PDB Description: hsc20 (hscb), a j-type co-chaperone from e. coli

SCOP Domain Sequences for d1fpoc1:

Sequence, based on SEQRES records: (download)

>d1fpoc1 a.2.3.1 (C:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli}
mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
lrhplmraeyllslhg

Sequence, based on observed residues (ATOM records): (download)

>d1fpoc1 a.2.3.1 (C:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli}
mdyftlfglparyqldtqalslrfqdlqrqlaavqqsatinqawqtlrhplmraeyllsl
hg

SCOP Domain Coordinates for d1fpoc1:

Click to download the PDB-style file with coordinates for d1fpoc1.
(The format of our PDB-style files is described here.)

Timeline for d1fpoc1: