Class a: All alpha proteins [46456] (290 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (2 proteins) |
Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries) Uniprot P20435; part of multichain biological unit |
Domain d3cqzf1: 3cqz F:72-155 [156931] Other proteins in same PDB: d3cqza1, d3cqzb_, d3cqzh_, d3cqzj_, d3cqzk_, d3cqzl1 automatically matched to d1i3qf_ protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3cqz (more details), 2.8 Å
SCOPe Domain Sequences for d3cqzf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cqzf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d3cqzf1: