Lineage for d3cpwy1 (3cpw Y:11-82)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036997Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 3036998Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 3036999Protein Ribosomal protein L37ae [57831] (1 species)
  7. 3037000Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 3037036Domain d3cpwy1: 3cpw Y:11-82 [156925]
    Other proteins in same PDB: d3cpw11, d3cpw21, d3cpwb1, d3cpwd1, d3cpwf1, d3cpwh1, d3cpwi1, d3cpwj1, d3cpwk1, d3cpwm1, d3cpwn1, d3cpwo1, d3cpwp1, d3cpwq1, d3cpwr1, d3cpws1, d3cpwt1, d3cpwu1, d3cpwv1, d3cpww1, d3cpwx1, d3cpwz1
    automatically matched to d1s72z_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwy1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Y:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3cpwy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpwy1 g.41.8.1 (Y:11-82) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3cpwy1:

Click to download the PDB-style file with coordinates for d3cpwy1.
(The format of our PDB-style files is described here.)

Timeline for d3cpwy1: