Lineage for d3cpwv1 (3cpw V:1-154)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3043938Domain d3cpwv1: 3cpw V:1-154 [156922]
    Other proteins in same PDB: d3cpw11, d3cpwb1, d3cpwf1, d3cpwh1, d3cpwo1, d3cpwq1, d3cpwr1, d3cpwx1, d3cpwy1
    automatically matched to d1w2bv_
    protein/RNA complex; complexed with ace, cd, cl, k, mg, na, sr, zld

Details for d3cpwv1

PDB Entry: 3cpw (more details), 2.7 Å

PDB Description: the structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d3cpwv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpwv1 i.1.1.2 (V:1-154) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d3cpwv1:

Click to download the PDB-style file with coordinates for d3cpwv1.
(The format of our PDB-style files is described here.)

Timeline for d3cpwv1: