Lineage for d3cpta_ (3cpt A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577625Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2577626Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2577649Protein MEK binding partner 1, MP1 [111120] (2 species)
    remote homolog that forms the characteristic complex structures with other members
  7. 2577650Species Human (Homo sapiens) [TaxId:9606] [111121] (3 PDB entries)
    Uniprot Q9UHA4
  8. 2577651Domain d3cpta_: 3cpt A: [156903]
    Other proteins in same PDB: d3cptb_
    automated match to d1skoa_

Details for d3cpta_

PDB Entry: 3cpt (more details), 1.9 Å

PDB Description: mp1-p14 scaffolding complex
PDB Compounds: (A:) Mitogen-activated protein kinase kinase 1-interacting protein 1

SCOPe Domain Sequences for d3cpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpta_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Human (Homo sapiens) [TaxId: 9606]}
ddlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgsk
lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvv

SCOPe Domain Coordinates for d3cpta_:

Click to download the PDB-style file with coordinates for d3cpta_.
(The format of our PDB-style files is described here.)

Timeline for d3cpta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cptb_