Lineage for d3cpha1 (3cph A:20-186)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363334Protein Rab-related protein Sec4 [52607] (1 species)
  7. 1363335Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (4 PDB entries)
  8. 1363342Domain d3cpha1: 3cph A:20-186 [156886]
    Other proteins in same PDB: d3cphg1, d3cphg2, d3cphg3, d3cphh1, d3cphh2, d3cphh3
    automatically matched to d2ocyc1
    complexed with gdp, mg

Details for d3cpha1

PDB Entry: 3cph (more details), 2.9 Å

PDB Description: Crystal structure of Sec4 in complex with Rab-GDI
PDB Compounds: (A:) Ras-related protein SEC4

SCOPe Domain Sequences for d3cpha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpha1 c.37.1.8 (A:20-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
imkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtagq
erfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdmet
rvvtadqgealakelgipfiessaknddnvneifftlakliqekids

SCOPe Domain Coordinates for d3cpha1:

Click to download the PDB-style file with coordinates for d3cpha1.
(The format of our PDB-style files is described here.)

Timeline for d3cpha1: