Lineage for d1h7xb1 (1h7x B:2-183)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 94345Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 94360Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 94361Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
  7. 94362Species Pig (Sus scrofa) [TaxId:9823] [46555] (2 PDB entries)
  8. 94368Domain d1h7xb1: 1h7x B:2-183 [15688]
    Other proteins in same PDB: d1h7xa2, d1h7xa3, d1h7xa4, d1h7xa5, d1h7xb2, d1h7xb3, d1h7xb4, d1h7xb5, d1h7xc2, d1h7xc3, d1h7xc4, d1h7xc5, d1h7xd2, d1h7xd3, d1h7xd4, d1h7xd5

Details for d1h7xb1

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil

SCOP Domain Sequences for d1h7xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa)}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOP Domain Coordinates for d1h7xb1:

Click to download the PDB-style file with coordinates for d1h7xb1.
(The format of our PDB-style files is described here.)

Timeline for d1h7xb1: