SCOPe 2.07: Domain d3cnwb2: 3cnw B:1-140

Lineage for d3cnwb2 (3cnw B:1-140)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.8: Atu1531-like [160742] (3 proteins)
   Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport

6. Protein Uncharacterized protein XoxI [160743] (1 species)

7. Species Bacillus cereus [TaxId:1396] [160744] (1 PDB entry)
   Uniprot Q81AY6 3-140

8. Domain d3cnwb2: 3cnw B:1-140 [156849]
   Other proteins in same PDB: d3cnwa2, d3cnwb3
   automated match to d3cnwa1

Details for d3cnwb2

PDB Entry: 3cnw, 2.48 Å

PDB Description: Three-dimensional structure of the protein XoxI (Q81AY6) from Bacillus cereus. Northeast Structural Genomics Consortium target BcR196.

PDB Compounds: (B:) Protein XoxI

SCOPe Domain Sequences for d3cnwb2:

Sequence; same for both SEQRES and ATOM records:

>d3cnwb2 d.129.3.8 (B:1-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]}
mnmahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiie
rlevfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeai
nlfhgiysdglkalqqafld

Timeline for d3cnwb2:

• d3cnwb2 first appeared in SCOP 1.75, called d3cnwb1
  
• d3cnwb2 appears in SCOPe 2.06
  
• d3cnwb2 appears in the current release, SCOPe 2.08