Lineage for d3cnwb2 (3cnw B:1-140)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582410Family d.129.3.8: Atu1531-like [160742] (3 proteins)
    Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport
  6. 2582415Protein Uncharacterized protein XoxI [160743] (1 species)
  7. 2582416Species Bacillus cereus [TaxId:1396] [160744] (1 PDB entry)
    Uniprot Q81AY6 3-140
  8. 2582418Domain d3cnwb2: 3cnw B:1-140 [156849]
    Other proteins in same PDB: d3cnwa2, d3cnwb3
    automated match to d3cnwa1

Details for d3cnwb2

PDB Entry: 3cnw (more details), 2.48 Å

PDB Description: Three-dimensional structure of the protein XoxI (Q81AY6) from Bacillus cereus. Northeast Structural Genomics Consortium target BcR196.
PDB Compounds: (B:) Protein XoxI

SCOPe Domain Sequences for d3cnwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cnwb2 d.129.3.8 (B:1-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]}
mnmahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiie
rlevfndkeryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeai
nlfhgiysdglkalqqafld

SCOPe Domain Coordinates for d3cnwb2:

Click to download the PDB-style file with coordinates for d3cnwb2.
(The format of our PDB-style files is described here.)

Timeline for d3cnwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cnwb3