SCOPe 2.04: Domain d3cmox1: 3cmo X:2-107

Lineage for d3cmox1 (3cmo X:2-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3cmox1: 3cmo X:2-107 [156839]
   Other proteins in same PDB: d3cmoh1, d3cmol2, d3cmox2, d3cmoy1
   automated match to d4m43l1

Details for d3cmox1

PDB Entry: 3cmo, 2.3 Å

PDB Description: hiv neutralizing monoclonal antibody yz18

PDB Compounds: (X:) Fab light chain

SCOPe Domain Sequences for d3cmox1:

Sequence; same for both SEQRES and ATOM records:

>d3cmox1 b.1.1.0 (X:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivmtqsssslsaslgdrvtiscrasqdisnylnwyqqkpdgtvelliyytsrlqsgvpsr
fsgsgsgsdysltisnlvpediatyycqqysklftfgsgtkleik

Timeline for d3cmox1:

• d3cmox1 first appeared in SCOP 1.75
  
• d3cmox1 appears in SCOPe 2.03
  
• d3cmox1 appears in SCOPe 2.05
  
• d3cmox1 appears in the current release, SCOPe 2.08