Lineage for d3cmna1 (3cmn A:43-391)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 868189Family d.92.1.16: Caur0242-like [160552] (1 protein)
    Pfam PF10103; DUF2342; there is a characteristic HExxH motif but no metal ion bound to it in the first structure.
  6. 868190Protein Uncharacterized protein Caur0242 [160553] (1 species)
  7. 868191Species Chloroflexus aurantiacus [TaxId:1108] [160554] (1 PDB entry)
    Uniprot A9WCA2 43-391
  8. 868192Domain d3cmna1: 3cmn A:43-391 [156835]

Details for d3cmna1

PDB Entry: 3cmn (more details), 2.25 Å

PDB Description: crystal structure of a putative hydrolase with a novel fold from chloroflexus aurantiacus
PDB Compounds: (A:) Putative hydrolase

SCOP Domain Sequences for d3cmna1:

Sequence, based on SEQRES records: (download)

>d3cmna1 d.92.1.16 (A:43-391) Uncharacterized protein Caur0242 {Chloroflexus aurantiacus [TaxId: 1108]}
lidweqarqaalrlsqweqapvdnrafrreqyarmvalsepliadylgvrlpepvsrifv
fdrrewleanivsfsqlfrpieemyekngggrgalgvlmndvsskllgvqiggllgylaq
rvlgqydlsllsaeatggslyfvepniarvqqqlglsdedfrlwitlhemthafefeayp
wvrtyfrelleqnfalvsgqmlssgnslvdmlmrllqgigsgqhwietvltpeqravfdr
iqalmsliegygnhvmnavgrrllpsfnqieqqiaqrqrqrtmldqmvfrltgldlklaq
yqqgeafvnavvaargiqfasrvwerpenlpsmdeirnpgqwivrm

Sequence, based on observed residues (ATOM records): (download)

>d3cmna1 d.92.1.16 (A:43-391) Uncharacterized protein Caur0242 {Chloroflexus aurantiacus [TaxId: 1108]}
lidweqarqaalrlsqweqapvdnrafrreqyarmvalsepliadylgvrlpepvsrifv
fdrrewleanivsfsqlfrpieemyeksskllgvqiggllgylaqrvlgqydlsllsagg
slyfvepniarvqqqlglsdedfrlwitlhemthafefeaypwvrtyfrelleqnfaltp
eqravfdriqalmsliegygnhvmnavgrrllpsfnqieqqiaqrqrqrtmldqmvfrlt
gldlklaqyqqgeafvnavvaargiqfasrvwerpenlpsmdeirnpgqwivrm

SCOP Domain Coordinates for d3cmna1:

Click to download the PDB-style file with coordinates for d3cmna1.
(The format of our PDB-style files is described here.)

Timeline for d3cmna1: