SCOP 1.75: Domain d3cmmb1: 3cmm B:1-76

Lineage for d3cmmb1 (3cmm B:1-76)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (6 PDB entries)

8. Domain d3cmmb1: 3cmm B:1-76 [156833]
   automatically matched to d1otrb_
   complexed with pro

Details for d3cmmb1

PDB Entry: 3cmm, 2.7 Å

PDB Description: crystal structure of the uba1-ubiquitin complex

PDB Compounds: (B:) Ubiquitin

SCOP Domain Sequences for d3cmmb1:

Sequence; same for both SEQRES and ATOM records:

>d3cmmb1 d.15.1.1 (B:1-76) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

Timeline for d3cmmb1:

• d3cmmb1 is new in SCOP 1.75
  
• d3cmmb1 is called d3cmmb_ in SCOPe 2.01
  
• d3cmmb1 appears in the current release, SCOPe 2.08, called d3cmmb_