SCOP 1.59: Domain d1qlbe1: 1qlb E:107-239

Lineage for d1qlbe1 (1qlb E:107-239)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)

5. Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)

6. Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)

7. Species Wolinella succinogenes [TaxId:844] [46552] (3 PDB entries)

8. Domain d1qlbe1: 1qlb E:107-239 [15682]
   Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb2, d1qlbc_, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe2, d1qlbf_

Details for d1qlbe1

PDB Entry: 1qlb, 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes

SCOP Domain Sequences for d1qlbe1:

Sequence; same for both SEQRES and ATOM records:

>d1qlbe1 a.1.2.1 (E:107-239) Fumarate reductase iron-sulfur protein, C-terminal domain {Wolinella succinogenes}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

Timeline for d1qlbe1:

• d1qlbe1 first appeared (with stable ids) in SCOP 1.55
  
• d1qlbe1 appears in SCOP 1.57
  
• d1qlbe1 appears in SCOP 1.61
  
• d1qlbe1 appears in the current release, SCOPe 2.08