Lineage for d1qlae1 (1qla E:107-239)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) 
Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) 
Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein) Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species) Species Wolinella succinogenes [TaxId:844] [46552] (3 PDB entries) 
Domain d1qlae1: 1qla E:107-239 [15680]
Other proteins in same PDB: d1qlaa1, d1qlaa2, d1qlaa3, d1qlab2, d1qlac_, d1qlad1, d1qlad2, d1qlad3, d1qlae2, d1qlaf_
Details for d1qlae1
PDB Entry: 1qla (more details), 2.2 Å
PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes
SCOP Domain Sequences for d1qlae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlae1 a.1.2.1 (E:107-239) Fumarate reductase iron-sulfur protein, C-terminal domain {Wolinella succinogenes}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn
SCOP Domain Coordinates for d1qlae1:
Click to download the PDB-style file with coordinates for d1qlae1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlae1:
- d1qlae1 first appeared (with stable ids) in SCOP 1.55
- d1qlae1 appears in SCOP 1.57
- d1qlae1 appears in SCOP 1.61
- d1qlae1 last appears in SCOP 1.71
View in 3D
