Lineage for d3cmat1 (3cma T:1-119)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2269333Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2269468Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2269615Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2269625Domain d3cmat1: 3cma T:1-119 [156789]
    Other proteins in same PDB: d3cma21, d3cmab1, d3cmaf1, d3cmah1, d3cmai1, d3cmap1, d3cmar1, d3cmas1, d3cmay1, d3cmaz1
    automatically matched to d1w2bs_
    protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr

Details for d3cmat1

PDB Entry: 3cma (more details), 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d3cmat1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmat1 i.1.1.2 (T:1-119) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d3cmat1:

Click to download the PDB-style file with coordinates for d3cmat1.
(The format of our PDB-style files is described here.)

Timeline for d3cmat1: