Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cmat1: 3cma T:1-119 [156789] Other proteins in same PDB: d3cma21, d3cmab1, d3cmaf1, d3cmah1, d3cmai1, d3cmap1, d3cmar1, d3cmas1, d3cmay1, d3cmaz1 automatically matched to d1w2bs_ protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr |
PDB Entry: 3cma (more details), 2.8 Å
SCOPe Domain Sequences for d3cmat1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cmat1 i.1.1.2 (T:1-119) 50S subunit {Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d3cmat1: