Lineage for d3cmaq1 (3cma Q:1-95)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249600Domain d3cmaq1: 3cma Q:1-95 [156786]
    Other proteins in same PDB: d3cma21, d3cmab1, d3cmaf1, d3cmah1, d3cmai1, d3cmap1, d3cmar1, d3cmas1, d3cmay1, d3cmaz1
    automatically matched to d1w2bp_
    protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr

Details for d3cmaq1

PDB Entry: 3cma (more details), 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d3cmaq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cmaq1 i.1.1.2 (Q:1-95) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d3cmaq1:

Click to download the PDB-style file with coordinates for d3cmaq1.
(The format of our PDB-style files is described here.)

Timeline for d3cmaq1: