SCOPe 2.02: Domain d3cmaf1: 3cma F:1-119

Lineage for d3cmaf1 (3cma F:1-119)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
   Uniprot P12743

8. Domain d3cmaf1: 3cma F:1-119 [156777]
   Other proteins in same PDB: d3cma11, d3cma21, d3cma31, d3cmab1, d3cmad1, d3cmah1, d3cmai1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmap1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1
   automatically matched to d1s72f_
   protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr

Details for d3cmaf1

PDB Entry: 3cma, 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3cmaf1:

Sequence; same for both SEQRES and ATOM records:

>d3cmaf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

Timeline for d3cmaf1:

• d3cmaf1 first appeared in SCOP 1.75
  
• d3cmaf1 appears in SCOPe 2.01
  
• d3cmaf1 appears in SCOPe 2.03
  
• d3cmaf1 appears in the current release, SCOPe 2.08