Lineage for d3cma21 (3cma 2:1-49)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925761Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 925762Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 925763Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 925764Protein Ribosomal protein L39e [48664] (1 species)
  7. 925765Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 925799Domain d3cma21: 3cma 2:1-49 [156773]
    Other proteins in same PDB: d3cma11, d3cma31, d3cmab1, d3cmad1, d3cmaf1, d3cmah1, d3cmai1, d3cmaj1, d3cmak1, d3cmal1, d3cman1, d3cmao1, d3cmap1, d3cmaq1, d3cmar1, d3cmas1, d3cmat1, d3cmau1, d3cmav1, d3cmaw1, d3cmax1, d3cmay1, d3cmaz1
    automatically matched to 1VQ4 2:1-49
    protein/RNA complex; complexed with cd, cl, k, mg, na, phe, sr

Details for d3cma21

PDB Entry: 3cma (more details), 2.8 Å

PDB Description: the structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3cma21:

Sequence, based on SEQRES records: (download)

>d3cma21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3cma21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d3cma21:

Click to download the PDB-style file with coordinates for d3cma21.
(The format of our PDB-style files is described here.)

Timeline for d3cma21: