Lineage for d1fumb1 (1fum B:106-243)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 44793Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 44794Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)
  6. 44795Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)
  7. 44796Species Escherichia coli [TaxId:562] [46551] (1 PDB entry)
  8. 44797Domain d1fumb1: 1fum B:106-243 [15677]
    Other proteins in same PDB: d1fuma1, d1fuma2, d1fuma3, d1fumb2, d1fumc_, d1fumd_, d1fumm1, d1fumm2, d1fumm3, d1fumn2, d1fumo_, d1fump_

Details for d1fumb1

PDB Entry: 1fum (more details), 3.3 Å

PDB Description: structure of the e. coli fumarate reductase respiratory complex

SCOP Domain Sequences for d1fumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fumb1 a.1.2.1 (B:106-243) Fumarate reductase iron-sulfur protein, C-terminal domain {Escherichia coli}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOP Domain Coordinates for d1fumb1:

Click to download the PDB-style file with coordinates for d1fumb1.
(The format of our PDB-style files is described here.)

Timeline for d1fumb1: