![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.12: SRA domain-like [159368] (2 proteins) Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA |
![]() | Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159370] (4 PDB entries) Uniprot Q96T88 409-615! Uniprot Q96T88 414-617 |
![]() | Domain d3clzd_: 3clz D: [156769] automated match to d3bi7a1 |
PDB Entry: 3clz (more details), 2.2 Å
SCOPe Domain Sequences for d3clzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3clzd_ b.122.1.12 (D:) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]} nhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdhgnf ftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaeakdwrsgkpvrv vrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkegk drikklgltmqypegylealanahhhhhh
Timeline for d3clzd_: