SCOPe 2.05: Domain d3cl1b_: 3cl1 B:

Lineage for d3cl1b_ (3cl1 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Rhizobium loti [TaxId:381] [187243] (3 PDB entries)

8. Domain d3cl1b_: 3cl1 B: [156751]
   automated match to d1vp6a_
   complexed with cl, k, pcg, pol

Details for d3cl1b_

PDB Entry: 3cl1, 2.4 Å

PDB Description: m. loti cyclic-nucleotide binding domain, cyclic-gmp bound

PDB Compounds: (B:) Mll3241 protein

SCOPe Domain Sequences for d3cl1b_:

Sequence; same for both SEQRES and ATOM records:

>d3cl1b_ b.82.3.2 (B:) automated matches {Rhizobium loti [TaxId: 381]}
rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg
svsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspeia
eifrktalerr

Timeline for d3cl1b_:

• d3cl1b_ first appeared in SCOP 1.75, called d3cl1b1
  
• d3cl1b_ appears in SCOPe 2.04
  
• d3cl1b_ appears in SCOPe 2.06
  
• d3cl1b_ appears in the current release, SCOPe 2.08