Lineage for d3ckcb1 (3ckc B:42-551)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775935Family a.118.8.6: SusD-like [158775] (3 proteins)
    TPR-like structure resides in the N-terminal part; the C-terminal part is structurally unique and is covered by Pfam PF07980
  6. 775936Protein Starch utilization system protein SusD [158780] (1 species)
  7. 775937Species Bacteroides thetaiotaomicron [TaxId:818] [158781] (5 PDB entries)
    Uniprot Q8A1G2 42-551
  8. 775939Domain d3ckcb1: 3ckc B:42-551 [156737]
    automatically matched to 3CK7 A:42-551
    complexed with ca, edo, mes, peg

Details for d3ckcb1

PDB Entry: 3ckc (more details), 1.5 Å

PDB Description: b. thetaiotaomicron susd
PDB Compounds: (B:) SusD

SCOP Domain Sequences for d3ckcb1:

Sequence, based on SEQRES records: (download)

>d3ckcb1 a.118.8.6 (B:42-551) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
fdqqgvfvkgyamlgvtgqkgidgspdldgqdegesgfyrttfncnelptdeclwawqkn
qdipqltsiswspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeirflral
hywyfldlfgkapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfgradka
anwllrarlylnagvytgqtdyakaeeyaskvigsayklctnyselfmadndenenamqe
iilpirqdgvktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsnledvp
mlpadveiptkgldtdeqidafdaehgirtedmikaagddrallysgvgggrrkiqtdai
sgftdglsivkwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggdatgdin
elrkranctrkvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkggamng
tsvasyynkypipvsdinnnrnmsqnegyk

Sequence, based on observed residues (ATOM records): (download)

>d3ckcb1 a.118.8.6 (B:42-551) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]}
fdqqgvfvkgyamlgvtgdgqdegesgfyrttfncnelptdeclwawqknqdipqltsis
wspssqrtewvyvrlgyditqynffldqtegmtdaetlrqraeirflralhywyfldlfg
kapfkehfsndlpvekkgtelytyiqnelneieadmyeprqapfgradkaanwllrarly
lnagvytgqtdyakaeeyaskvigsayklctnyselfmadndenenamqeiilpirqdgv
ktrnyggstylvcgtrvagmprmgttngwscifaraamvqkffsnledvpmlpadveipt
kgldtdeqidafdaehgirtedmikaagddrallysgvgggrrkiqtdaisgftdglsiv
kwqnyrsdgkpvshatypdtdiplfrlaeayltraeaifrqggdatgdinelrkranctr
kvqtvteqelidewarefylegrrrsdlvrfgmfttnkylwdwkggamngtsvasyynky
pipvsdinnnrnmsqnegyk

SCOP Domain Coordinates for d3ckcb1:

Click to download the PDB-style file with coordinates for d3ckcb1.
(The format of our PDB-style files is described here.)

Timeline for d3ckcb1: