Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries) |
Domain d3ciud1: 3ciu D:2-146 [156696] Other proteins in same PDB: d3ciua1, d3ciuc1 automatically matched to d1fsxb_ complexed with 5dp, hem, o |
PDB Entry: 3ciu (more details), 3.5 Å
SCOPe Domain Sequences for d3ciud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ciud1 a.1.1.2 (D:2-146) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]} mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke ftpvlqadfqkvvagvanalahryh
Timeline for d3ciud1: