SCOPe 2.07: Domain d3ciud1: 3ciu D:2-146

Lineage for d3ciud1 (3ciu D:2-146)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries)

8. Domain d3ciud1: 3ciu D:2-146 [156696]
   Other proteins in same PDB: d3ciua1, d3ciuc1
   automatically matched to d1fsxb_
   complexed with 5dp, hem, o

Details for d3ciud1

PDB Entry: 3ciu, 3.5 Å

PDB Description: Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3ciud1:

Sequence; same for both SEQRES and ATOM records:

>d3ciud1 a.1.1.2 (D:2-146) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

Timeline for d3ciud1:

• d3ciud1 first appeared in SCOP 1.75
  
• d3ciud1 appears in SCOPe 2.06
  
• d3ciud1 appears in the current release, SCOPe 2.08