SCOPe 2.07: Domain d3ciuc1: 3ciu C:1-141

Lineage for d3ciuc1 (3ciu C:1-141)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries)

8. Domain d3ciuc1: 3ciu C:1-141 [156695]
   Other proteins in same PDB: d3ciub1, d3ciud1
   automatically matched to d1fsxa_
   complexed with 5dp, hem, o

Details for d3ciuc1

PDB Entry: 3ciu, 3.5 Å

PDB Description: Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic

PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3ciuc1:

Sequence; same for both SEQRES and ATOM records:

>d3ciuc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

Timeline for d3ciuc1:

• d3ciuc1 first appeared in SCOP 1.75
  
• d3ciuc1 appears in SCOPe 2.06
  
• d3ciuc1 appears in the current release, SCOPe 2.08