Lineage for d3ciuc1 (3ciu C:1-141)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716111Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries)
  8. 1716133Domain d3ciuc1: 3ciu C:1-141 [156695]
    Other proteins in same PDB: d3ciub1, d3ciud1
    automatically matched to d1fsxa_
    complexed with 5dp, hem, o

Details for d3ciuc1

PDB Entry: 3ciu (more details), 3.5 Å

PDB Description: Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3ciuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ciuc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d3ciuc1:

Click to download the PDB-style file with coordinates for d3ciuc1.
(The format of our PDB-style files is described here.)

Timeline for d3ciuc1: