Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) |
Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
Protein Fumarate reductase [56429] (2 species) |
Species Escherichia coli [TaxId:562] [56430] (5 PDB entries) |
Domain d3cirm3: 3cir M:226-357 [156688] Other proteins in same PDB: d3cira1, d3cira2, d3cirb1, d3cirb2, d3circ1, d3cird1, d3cirm1, d3cirm2, d3cirn1, d3cirn2, d3ciro1, d3cirp1 automatically matched to d1kf6a3 complexed with f3s, fad, fes, sf4; mutant |
PDB Entry: 3cir (more details), 3.65 Å
SCOPe Domain Sequences for d3cirm3:
Sequence, based on SEQRES records: (download)
>d3cirm3 d.168.1.1 (M:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} mefvqyhpaglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk epipvrptahyt
>d3cirm3 d.168.1.1 (M:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} mefvqyhpaglpgsgilmtegcrdkvsqafwhewrkgntiskklheficelakaypvrpt ahyt
Timeline for d3cirm3: