Lineage for d3cipg_ (3cip G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922095Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1922096Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1922097Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1922098Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1922115Species Human (Homo sapiens) [TaxId:9606] [55761] (32 PDB entries)
    Uniprot P20065 55-179
  8. 1922116Domain d3cipg_: 3cip G: [156678]
    Other proteins in same PDB: d3cipa1, d3cipa2
    automated match to d1yagg_
    complexed with atp, ca, gol, mg, so4

Details for d3cipg_

PDB Entry: 3cip (more details), 1.6 Å

PDB Description: complex of dictyostelium discoideum actin with gelsolin
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d3cipg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cipg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
aghmvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnl
qydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkyk
kggvasgf

SCOPe Domain Coordinates for d3cipg_:

Click to download the PDB-style file with coordinates for d3cipg_.
(The format of our PDB-style files is described here.)

Timeline for d3cipg_: