SCOP 1.75: Domain d3cipg1: 3cip G:2-125

Lineage for d3cipg1 (3cip G:2-125)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (28 PDB entries)
   Uniprot P20065 55-179

8. Domain d3cipg1: 3cip G:2-125 [156678]
   automatically matched to d1p8zg_
   complexed with atp, ca, gol, mg, so4

Details for d3cipg1

PDB Entry: 3cip, 1.6 Å

PDB Description: complex of dictyostelium discoideum actin with gelsolin

PDB Compounds: (G:) gelsolin

SCOP Domain Sequences for d3cipg1:

Sequence; same for both SEQRES and ATOM records:

>d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asgf

Timeline for d3cipg1:

• d3cipg1 is new in SCOP 1.75
  
• d3cipg1 is called d3cipg_ in SCOPe 2.01
  
• d3cipg1 appears in the current release, SCOPe 2.08, called d3cipg2