Lineage for d3ciii1 (3cii I:59-179)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001365Protein CD94 [56440] (1 species)
  7. 3001366Species Human (Homo sapiens) [TaxId:9606] [56441] (4 PDB entries)
  8. 3001373Domain d3ciii1: 3cii I:59-179 [156677]
    Other proteins in same PDB: d3ciia1, d3ciia2, d3ciib1, d3ciib2, d3ciid1, d3ciid2, d3ciie1, d3ciie2
    automatically matched to d1b6ea_

Details for d3ciii1

PDB Entry: 3cii (more details), 4.41 Å

PDB Description: Structure of NKG2A/CD94 bound to HLA-E
PDB Compounds: (I:) Natural killer cells antigen CD94

SCOPe Domain Sequences for d3ciii1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ciii1 d.169.1.1 (I:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]}
cscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywig
lsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqql
i

SCOPe Domain Coordinates for d3ciii1:

Click to download the PDB-style file with coordinates for d3ciii1.
(The format of our PDB-style files is described here.)

Timeline for d3ciii1: