Lineage for d3ciia2 (3cii A:2-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856544Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 856560Domain d3ciia2: 3cii A:2-181 [156671]
    Other proteins in same PDB: d3ciia1, d3ciib1, d3ciid1, d3ciie1, d3ciig1, d3ciii1
    automatically matched to d1mhea2

Details for d3ciia2

PDB Entry: 3cii (more details), 4.41 Å

PDB Description: Structure of NKG2A/CD94 bound to HLA-E
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain E

SCOP Domain Sequences for d3ciia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ciia2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOP Domain Coordinates for d3ciia2:

Click to download the PDB-style file with coordinates for d3ciia2.
(The format of our PDB-style files is described here.)

Timeline for d3ciia2: