Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
Protein Phycoerythrin alpha subunit [88961] (3 species) |
Species Red alga (Griffithsia monilis) [TaxId:42003] [88511] (1 PDB entry) |
Domain d1b8da_: 1b8d A: [15665] Other proteins in same PDB: d1b8db_, d1b8dl_ |
PDB Entry: 1b8d (more details), 1.9 Å
SCOP Domain Sequences for d1b8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8da_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red alga (Griffithsia monilis) [TaxId: 42003]} mksvitttisaadaagrfpsssdlesiqgniqraaarleaaqklsgnheavvkeagdacf akysylknageagdspekinkcyrdidhymrlinyslvvggtgpvdewgiagsrevyral nlpgsayiaaftftrdrlcvprdmssqagveftsaldyvinslc
Timeline for d1b8da_: