SCOP 1.67: Domain d1lial_: 1lia L:

Lineage for d1lial_ (1lia L:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88514] (1 PDB entry)

8. Domain d1lial_: 1lia L: [15664]
   Other proteins in same PDB: d1liaa_, d1liak_
   complexed with cyb, cyc

Details for d1lial_

PDB Entry: 1lia, 2.8 Å

PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution

SCOP Domain Sequences for d1lial_:

Sequence; same for both SEQRES and ATOM records:

>d1lial_ a.1.1.3 (L:) Phycoerythrin beta subunit {Red alga (Polysiphonia urceolata)}
mldafsrvvvnsdskaayvsgsdlqalktfindgnkrldavnyivsnsscivsdaisgmi
cenpglitpggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnstvravsimkaaavcfisntasqrkveviegdcsalasevasycdrvvaavs

Timeline for d1lial_:

• d1lial_ first appeared (with stable ids) in SCOP 1.55
  
• d1lial_ appears in SCOP 1.65
  
• d1lial_ appears in SCOP 1.69
  
• d1lial_ appears in the current release, SCOPe 2.08