SCOP 1.75: Domain d3cheb2: 3che B:299-360

Lineage for d3cheb2 (3che B:299-360)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase 1 [54562] (2 species)

7. Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries)
   Uniprot Q873X9

8. Domain d3cheb2: 3che B:299-360 [156636]
   Other proteins in same PDB: d3chea1, d3cheb1
   automatically matched to d1w9pa2
   complexed with so4, vrg

Details for d3cheb2

PDB Entry: 3che, 2.05 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with tripeptide

PDB Compounds: (B:) chitinase

SCOP Domain Sequences for d3cheb2:

Sequence; same for both SEQRES and ATOM records:

>d3cheb2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

Timeline for d3cheb2:

• d3cheb2 is new in SCOP 1.75
  
• d3cheb2 appears in SCOPe 2.01
  
• d3cheb2 appears in the current release, SCOPe 2.08