SCOP 1.63: Domain d1liak_: 1lia K:

Lineage for d1liak_ (1lia K:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
   oligomers of two different types of homologous subunits
   each subunit contains 2 additional helices at the N-terminus
   binds a chromophore

6. Protein Phycoerythrin [46540] (5 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [46541] (1 PDB entry)

8. Domain d1liak_: 1lia K: [15663]

Details for d1liak_

PDB Entry: 1lia, 2.8 Å

PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution

SCOP Domain Sequences for d1liak_:

Sequence; same for both SEQRES and ATOM records:

>d1liak_ a.1.1.3 (K:) Phycoerythrin {Red alga (Polysiphonia urceolata)}
mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls

Timeline for d1liak_:

• d1liak_ first appeared (with stable ids) in SCOP 1.55
  
• d1liak_ appears in SCOP 1.61
  
• d1liak_ appears in SCOP 1.65
  
• d1liak_ appears in the current release, SCOPe 2.08