Lineage for d3cgoa1 (3cgo A:45-400)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874380Protein c-jun N-terminal kinase (jnk3s) [56137] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 874381Species Human (Homo sapiens) [TaxId:9606] [56138] (16 PDB entries)
  8. 874398Domain d3cgoa1: 3cgo A:45-400 [156619]
    automatically matched to d1jnka_
    complexed with jno

Details for d3cgoa1

PDB Entry: 3cgo (more details), 3 Å

PDB Description: irak-4 inhibitors (part ii)- a structure based assessment of imidazo[1,2 a]pyridine binding
PDB Compounds: (A:) Mitogen-activated protein kinase 10

SCOP Domain Sequences for d3cgoa1:

Sequence, based on SEQRES records: (download)

>d3cgoa1 d.144.1.7 (A:45-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyv
vtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcp
efmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidp
akrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn

Sequence, based on observed residues (ATOM records): (download)

>d3cgoa1 d.144.1.7 (A:45-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryy
rapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkk
lqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakris
vddalqhpyinvwyrehtieewkeliykevmn

SCOP Domain Coordinates for d3cgoa1:

Click to download the PDB-style file with coordinates for d3cgoa1.
(The format of our PDB-style files is described here.)

Timeline for d3cgoa1: