SCOP 1.65: Domain d1liaa_: 1lia A:

Lineage for d1liaa_ (1lia A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin alpha subunit [88961] (3 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88510] (1 PDB entry)

8. Domain d1liaa_: 1lia A: [15661]
   Other proteins in same PDB: d1liab_, d1lial_

Details for d1liaa_

PDB Entry: 1lia, 2.8 Å

PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution

SCOP Domain Sequences for d1liaa_:

Sequence; same for both SEQRES and ATOM records:

>d1liaa_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red alga (Polysiphonia urceolata)}
mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls

Timeline for d1liaa_:

• d1liaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1liaa_ appears in SCOP 1.63
  
• d1liaa_ appears in SCOP 1.67
  
• d1liaa_ appears in the current release, SCOPe 2.08