Lineage for d1b33m_ (1b33 M:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 209451Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
    oligomers of two different types of homologous subunits
    each subunit contains 2 additional helices at the N-terminus
    binds a chromophore
  6. 209452Protein Allophycocyanin [46537] (3 species)
  7. 209453Species Cyanobacterium (Mastigocladus laminosus) [TaxId:83541] [46539] (1 PDB entry)
  8. 209465Domain d1b33m_: 1b33 M: [15660]
    Other proteins in same PDB: d1b33n_, d1b33o_
    complexed with bo4, ch3, cyc

Details for d1b33m_

PDB Entry: 1b33 (more details), 2.3 Å

PDB Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8

SCOP Domain Sequences for d1b33m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b33m_ a.1.1.3 (M:) Allophycocyanin {Cyanobacterium (Mastigocladus laminosus)}
mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls

SCOP Domain Coordinates for d1b33m_:

Click to download the PDB-style file with coordinates for d1b33m_.
(The format of our PDB-style files is described here.)

Timeline for d1b33m_: