Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like [46532] (4 proteins) oligomers of two different types of homologous subunits each subunit contains 2 additional helices at the N-terminus binds a chromophore |
Protein Allophycocyanin [46537] (3 species) |
Species Cyanobacterium (Mastigocladus laminosus) [TaxId:83541] [46539] (1 PDB entry) |
Domain d1b33m_: 1b33 M: [15660] Other proteins in same PDB: d1b33n_, d1b33o_ complexed with bo4, ch3, cyc |
PDB Entry: 1b33 (more details), 2.3 Å
SCOP Domain Sequences for d1b33m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b33m_ a.1.1.3 (M:) Allophycocyanin {Cyanobacterium (Mastigocladus laminosus)} mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
Timeline for d1b33m_: