SCOP 1.75: Domain d3cfkj1: 3cfk J:1-107

Lineage for d3cfkj1 (3cfk J:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)

8. Domain d3cfkj1: 3cfk J:1-107 [156599]
   Other proteins in same PDB: d3cfka2, d3cfkb1, d3cfkb2, d3cfkc2, d3cfkd1, d3cfkd2, d3cfke2, d3cfkf1, d3cfkf2, d3cfkg2, d3cfkh1, d3cfkh2, d3cfki1, d3cfki2, d3cfkj2, d3cfkk1, d3cfkk2, d3cfkl2, d3cfkm2, d3cfkn1, d3cfkn2, d3cfko2, d3cfkp1, d3cfkp2
   automatically matched to d1g9ml1
   complexed with b3p, cd, gol; mutant

Details for d3cfkj1

PDB Entry: 3cfk, 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, triclinic crystal form

PDB Compounds: (J:) Catalytic Antibody Fab 34E4 Light chain

SCOP Domain Sequences for d3cfkj1:

Sequence; same for both SEQRES and ATOM records:

>d3cfkj1 b.1.1.1 (J:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleik

Timeline for d3cfkj1:

• d3cfkj1 is new in SCOP 1.75
  
• d3cfkj1 appears in SCOPe 2.01
  
• d3cfkj1 appears in the current release, SCOPe 2.08