Lineage for d3cfjl2 (3cfj L:108-212)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786055Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
    SQ NA # humanized antibody
    Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
    SQ P01834 # KAC_HUMAN Ig kappa chain C region.
    SQ NA # engineered antibody
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 786157Domain d3cfjl2: 3cfj L:108-212 [156580]
    Other proteins in same PDB: d3cfja1, d3cfjb1, d3cfjb2, d3cfjc1, d3cfjd1, d3cfjd2, d3cfje1, d3cfjf1, d3cfjf2, d3cfjh1, d3cfjh2, d3cfjl1
    automatically matched to d1g9ml2
    complexed with gol, so4; mutant

Details for d3cfjl2

PDB Entry: 3cfj (more details), 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, orthorhombic crystal form
PDB Compounds: (L:) Catalytic Antibody Fab 34E4 Light chain

SCOP Domain Sequences for d3cfjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfjl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d3cfjl2:

Click to download the PDB-style file with coordinates for d3cfjl2.
(The format of our PDB-style files is described here.)

Timeline for d3cfjl2: